Recombinant Human FSHR protein, hFc-tagged
Cat.No. : | FSHR-4260H |
Product Overview : | Recombinant Human FSHR protein(P23945)(18-366aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 18-366aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68.8 kDa |
AA Sequence : | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | FSHR follicle stimulating hormone receptor [ Homo sapiens ] |
Official Symbol | FSHR |
Synonyms | FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668; |
Gene ID | 2492 |
mRNA Refseq | NM_000145 |
Protein Refseq | NP_000136 |
MIM | 136435 |
UniProt ID | P23945 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSHR Products
Required fields are marked with *
My Review for All FSHR Products
Required fields are marked with *
0
Inquiry Basket