"FTCD" Related Products

Expand
Expand

Recombinant Human FTCD Protein, GST-tagged

Cat.No. : FTCD-4530H
Product Overview : Human FTCD partial ORF ( NP_996848, 440 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal.
Description : FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.96 kDa
AA Sequence : LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : FTCD formiminotransferase cyclodeaminase [ Homo sapiens ]
Official Symbol : FTCD
Synonyms : FTCD; formiminotransferase cyclodeaminase; formimidoyltransferase-cyclodeaminase; formiminotransferase-cyclodeaminase; formimidoyltransferase cyclodeaminase; LCHC1;
Gene ID : 10841
mRNA Refseq : NM_006657
Protein Refseq : NP_006648
MIM : 606806
UniProt ID : O95954

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.