Recombinant Human FTCD Protein, GST-tagged

Cat.No. : FTCD-4530H
Product Overview : Human FTCD partial ORF ( NP_996848, 440 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM
Molecular Mass : 36.96 kDa
AA Sequence : LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FTCD formiminotransferase cyclodeaminase [ Homo sapiens ]
Official Symbol FTCD
Synonyms FTCD; formiminotransferase cyclodeaminase; formimidoyltransferase-cyclodeaminase; formiminotransferase-cyclodeaminase; formimidoyltransferase cyclodeaminase; LCHC1;
Gene ID 10841
mRNA Refseq NM_006657
Protein Refseq NP_006648
MIM 606806
UniProt ID O95954

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTCD Products

Required fields are marked with *

My Review for All FTCD Products

Required fields are marked with *

0
cart-icon
0
compare icon