Recombinant Human FTCD Protein, GST-tagged
Cat.No. : | FTCD-4530H |
Product Overview : | Human FTCD partial ORF ( NP_996848, 440 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM |
Molecular Mass : | 36.96 kDa |
AA Sequence : | LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FTCD formiminotransferase cyclodeaminase [ Homo sapiens ] |
Official Symbol | FTCD |
Synonyms | FTCD; formiminotransferase cyclodeaminase; formimidoyltransferase-cyclodeaminase; formiminotransferase-cyclodeaminase; formimidoyltransferase cyclodeaminase; LCHC1; |
Gene ID | 10841 |
mRNA Refseq | NM_006657 |
Protein Refseq | NP_006648 |
MIM | 606806 |
UniProt ID | O95954 |
◆ Recombinant Proteins | ||
FTCD-3300H | Recombinant Human FTCD protein(Met1-Glu541), His-tagged | +Inquiry |
FTCD-13023H | Recombinant Human FTCD, His-tagged | +Inquiry |
Ftcd-3096M | Recombinant Mouse Ftcd Protein, Myc/DDK-tagged | +Inquiry |
FTCD-2057R | Recombinant Rat FTCD Protein, His (Fc)-Avi-tagged | +Inquiry |
FTCD-1103HFL | Recombinant Full Length Human FTCD Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTCD-6129HCL | Recombinant Human FTCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTCD Products
Required fields are marked with *
My Review for All FTCD Products
Required fields are marked with *
0
Inquiry Basket