Recombinant Human FTCD Protein, GST-tagged

• Cat.No.: FTCD-4530H
• Product Overview: Human FTCD partial ORF ( NP_996848, 440 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM
• Molecular Mass: 36.96 kDa
• AA Sequence: LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FTCD formiminotransferase cyclodeaminase [ Homo sapiens ]
• Official Symbol: FTCD
• Synonyms: FTCD; formiminotransferase cyclodeaminase; formimidoyltransferase-cyclodeaminase; formiminotransferase-cyclodeaminase; formimidoyltransferase cyclodeaminase; LCHC1
• Gene ID: 10841
• mRNA Refseq: NM_006657
• Protein Refseq: NP_006648
• MIM: 606806
• UniProt ID: O95954