Recombinant Human FTSJ2 Protein, His-tagged

• Cat.No.: FTSJ2-4537H
• Product Overview: Human FTSJ2 (NP_037525, 51 a.a. - 246 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-561 a.a.
• Description: The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 24.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSSYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: In 20 mM Tris-HCl buffer, pH 8.0 (0.15M NaCl, 30% glycerol, 1mM DTT).

Gene Information

• Gene Name: FTSJ2 FtsJ homolog 2 (E. coli) [ Homo sapiens ]
• Official Symbol: FTSJ2
• Synonyms: FTSJ2; FtsJ homolog 2 (E. coli); putative ribosomal RNA methyltransferase 2; cell division protein FtsJ; FJH1; rRNA (uridine 2 O ) methyltransferase; protein ftsJ homolog 2; rRNA (uridine-2-O-)-methyltransferase; DKFZp686J14194
• Gene ID: 29960
• mRNA Refseq: NM_013393
• Protein Refseq: NP_037525
• MIM: 606906
• UniProt ID: Q9UI43