Recombinant Human FTSJ2 Protein, His-tagged

Cat.No. : FTSJ2-4537H
Product Overview : Human FTSJ2 (NP_037525, 51 a.a. - 246 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-561 a.a.
Description : The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq
Form : Liquid
Molecular Mass : 24.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSSYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 20 mM Tris-HCl buffer, pH 8.0 (0.15M NaCl, 30% glycerol, 1mM DTT).
Gene Name FTSJ2 FtsJ homolog 2 (E. coli) [ Homo sapiens ]
Official Symbol FTSJ2
Synonyms FTSJ2; FtsJ homolog 2 (E. coli); putative ribosomal RNA methyltransferase 2; cell division protein FtsJ; FJH1; rRNA (uridine 2 O ) methyltransferase; protein ftsJ homolog 2; rRNA (uridine-2-O-)-methyltransferase; DKFZp686J14194;
Gene ID 29960
mRNA Refseq NM_013393
Protein Refseq NP_037525
MIM 606906
UniProt ID Q9UI43

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTSJ2 Products

Required fields are marked with *

My Review for All FTSJ2 Products

Required fields are marked with *

0
cart-icon
0
compare icon