Recombinant Human FTSJ2 Protein, His-tagged
Cat.No. : | FTSJ2-4537H |
Product Overview : | Human FTSJ2 (NP_037525, 51 a.a. - 246 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-561 a.a. |
Description : | The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 24.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSSYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | In 20 mM Tris-HCl buffer, pH 8.0 (0.15M NaCl, 30% glycerol, 1mM DTT). |
Gene Name | FTSJ2 FtsJ homolog 2 (E. coli) [ Homo sapiens ] |
Official Symbol | FTSJ2 |
Synonyms | FTSJ2; FtsJ homolog 2 (E. coli); putative ribosomal RNA methyltransferase 2; cell division protein FtsJ; FJH1; rRNA (uridine 2 O ) methyltransferase; protein ftsJ homolog 2; rRNA (uridine-2-O-)-methyltransferase; DKFZp686J14194; |
Gene ID | 29960 |
mRNA Refseq | NM_013393 |
Protein Refseq | NP_037525 |
MIM | 606906 |
UniProt ID | Q9UI43 |
◆ Recombinant Proteins | ||
FTSJ2-4537H | Recombinant Human FTSJ2 Protein, His-tagged | +Inquiry |
FTSJ2-6075M | Recombinant Mouse FTSJ2 Protein | +Inquiry |
FTSJ2-4931C | Recombinant Chicken FTSJ2 | +Inquiry |
FTSJ2-4538H | Recombinant Human FTSJ2 Protein, GST-tagged | +Inquiry |
FTSJ2-3383M | Recombinant Mouse FTSJ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTSJ2-6123HCL | Recombinant Human FTSJ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTSJ2 Products
Required fields are marked with *
My Review for All FTSJ2 Products
Required fields are marked with *