Recombinant Human FTSJ2 Protein, GST-tagged
Cat.No. : | FTSJ2-4538H |
Product Overview : | Human FTSJ2 partial ORF ( NP_037525, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq |
Molecular Mass : | 37.07 kDa |
AA Sequence : | MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FTSJ2 FtsJ homolog 2 (E. coli) [ Homo sapiens ] |
Official Symbol | FTSJ2 |
Synonyms | FTSJ2; FtsJ homolog 2 (E. coli); putative ribosomal RNA methyltransferase 2; cell division protein FtsJ; FJH1; rRNA (uridine 2 O ) methyltransferase; protein ftsJ homolog 2; rRNA (uridine-2-O-)-methyltransferase; DKFZp686J14194; |
Gene ID | 29960 |
mRNA Refseq | NM_013393 |
Protein Refseq | NP_037525 |
MIM | 606906 |
UniProt ID | Q9UI43 |
◆ Recombinant Proteins | ||
FTSJ2-1581R | Recombinant Rhesus Macaque FTSJ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FTSJ2-4537H | Recombinant Human FTSJ2 Protein, His-tagged | +Inquiry |
FTSJ2-4538H | Recombinant Human FTSJ2 Protein, GST-tagged | +Inquiry |
FTSJ2-1760R | Recombinant Rhesus monkey FTSJ2 Protein, His-tagged | +Inquiry |
FTSJ2-4931C | Recombinant Chicken FTSJ2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTSJ2-6123HCL | Recombinant Human FTSJ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTSJ2 Products
Required fields are marked with *
My Review for All FTSJ2 Products
Required fields are marked with *