Recombinant Human Full Length CCR9 protein, His-tagged(VLPs)
Cat.No. : | CCR9-16H |
Product Overview : | Recombinant Human Full Length CCR9 protein(P51686)(1-369aa), fused with His tag, was expressed in HEK293, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-369aa |
Form : | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4. |
Molecular Mass : | 43.4 kDa |
AA Sequence : | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. |
Gene Name | CCR9 chemokine (C-C motif) receptor 9 [ Homo sapiens ] |
Official Symbol | CCR9 |
Synonyms | CCR9; chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9 |
Gene ID | 10803 |
mRNA Refseq | NM_001256369 |
Protein Refseq | NP_001243298 |
MIM | 604738 |
UniProt ID | P51686 |
◆ Recombinant Proteins | ||
CCR9-129C | Recombinant Cynomolgus Monkey CCR9 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35509MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 9(Ccr9) Protein, His-Tagged | +Inquiry |
CCR9-04H | Recombinant Human CCR9 Protein, C-hFc-tagged | +Inquiry |
CCR9-0699H | Recombinant Human CCR9 Protein | +Inquiry |
CCR9-16H | Recombinant Human Full Length CCR9 protein, His-tagged(VLPs) | +Inquiry |
◆ Native Proteins | ||
CCR9-13HCL | Recombinant Full Length Human CCR9 Over-expression Lysate, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR9-310HCL | Recombinant Human CCR9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR9 Products
Required fields are marked with *
My Review for All CCR9 Products
Required fields are marked with *