Recombinant Human Full Length CCR9 protein, His-tagged(VLPs)

Cat.No. : CCR9-16H
Product Overview : Recombinant Human Full Length CCR9 protein(P51686)(1-369aa), fused with His tag, was expressed in HEK293,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-369aa
Form : Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Molecular Mass : 43.4 kDa
AA Sequence : MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Gene Name CCR9 chemokine (C-C motif) receptor 9 [ Homo sapiens ]
Official Symbol CCR9
Synonyms CCR9; chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9
Gene ID 10803
mRNA Refseq NM_001256369
Protein Refseq NP_001243298
MIM 604738
UniProt ID P51686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCR9 Products

Required fields are marked with *

My Review for All CCR9 Products

Required fields are marked with *

0
cart-icon
0
compare icon