Recombinant Human Full length IFNA2 protein(1-188 aa), C-His-tagged

Cat.No. : IFNA2-2881H
Product Overview : Recombinant Human Full length IFNA2 protein(P01563)(1-188 aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-188 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 20.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Gene Name IFNA2 interferon, alpha 2 [ Homo sapiens ]
Official Symbol IFNA2
Synonyms IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765;
Gene ID 3440
mRNA Refseq NM_000605
Protein Refseq NP_000596
MIM 147562
UniProt ID P01563

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNA2 Products

Required fields are marked with *

My Review for All IFNA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon