Recombinant Human Full length MOBP protein(1-183 aa), N-MBP & C-His-tagged

• Cat.No.: MOBP-2894H
• Product Overview: Recombinant Human Full length MOBP protein(Q13875)(1-183 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 1-183 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRTSRRAKSPQRPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSPPRSERQPRSPPRSERQPRPRPEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSPVKASRFW

Gene Information

• Gene Name: MOBP myelin-associated oligodendrocyte basic protein [ Homo sapiens ]
• Official Symbol: MOBP
• Synonyms: MOBP; myelin-associated oligodendrocyte basic protein; MGC87379
• Gene ID: 4336
• mRNA Refseq: NM_182935
• Protein Refseq: NP_891980
• MIM: 600948
• UniProt ID: Q13875