Recombinant Human Full length PTMA protein(1-111 aa), N-SUMO & N-His-tagged

Cat.No. : PTMA-2880H
Product Overview : Recombinant Human Full length PTMA protein(P06454)(1-111 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-111 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Gene Name PTMA prothymosin, alpha [ Homo sapiens ]
Official Symbol PTMA
Synonyms PTMA; prothymosin, alpha; prothymosin, alpha (gene sequence 28) , TMSA; prothymosin alpha; gene sequence 28; prothymosin alpha protein; TMSA; MGC104802;
Gene ID 5757
mRNA Refseq NM_001099285
Protein Refseq NP_001092755
MIM 188390
UniProt ID P06454

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTMA Products

Required fields are marked with *

My Review for All PTMA Products

Required fields are marked with *

0
cart-icon
0
compare icon