Recombinant Human PTMA Protein (1-111 aa), His-tagged

• Cat.No.: PTMA-2248H
• Product Overview: Recombinant Human PTMA Protein (1-111 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-111 aa
• Description: Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.2 kDa
• AA Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PTMA prothymosin, alpha [ Homo sapiens ]
• Official Symbol: PTMA
• Synonyms: PTMA; prothymosin, alpha; prothymosin alpha; gene sequence 28; prothymosin alpha protein; TMSA; MGC104802
• Gene ID: 5757
• mRNA Refseq: NM_001099285
• Protein Refseq: NP_001092755
• MIM: 188390
• UniProt ID: P06454