Recombinant Human PTMA Protein (1-111 aa), His-tagged
Cat.No. : | PTMA-2248H |
Product Overview : | Recombinant Human PTMA Protein (1-111 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-111 aa |
Description : | Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | PTMA prothymosin, alpha [ Homo sapiens ] |
Official Symbol | PTMA |
Synonyms | PTMA; prothymosin, alpha; prothymosin alpha; gene sequence 28; prothymosin alpha protein; TMSA; MGC104802; |
Gene ID | 5757 |
mRNA Refseq | NM_001099285 |
Protein Refseq | NP_001092755 |
MIM | 188390 |
UniProt ID | P06454 |
◆ Recombinant Proteins | ||
PTMA-2318H | Recombinant Human PTMA, His-tagged | +Inquiry |
PTMA-2382H | Recombinant Human Prothymosin, Alpha, 1-109aa | +Inquiry |
PTMA-13661M | Recombinant Mouse PTMA Protein | +Inquiry |
Ptma-1343R | Recombinant Rat Ptma Protein, His-tagged | +Inquiry |
PTMA-2879H | Recombinant Human Full length PTMA protein(1-111 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTMA-516HCL | Recombinant Human PTMA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTMA Products
Required fields are marked with *
My Review for All PTMA Products
Required fields are marked with *