Recombinant Human PTMA Protein (1-111 aa), His-tagged

Cat.No. : PTMA-2248H
Product Overview : Recombinant Human PTMA Protein (1-111 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-111 aa
Description : Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.2 kDa
AA Sequence : MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name PTMA prothymosin, alpha [ Homo sapiens ]
Official Symbol PTMA
Synonyms PTMA; prothymosin, alpha; prothymosin alpha; gene sequence 28; prothymosin alpha protein; TMSA; MGC104802;
Gene ID 5757
mRNA Refseq NM_001099285
Protein Refseq NP_001092755
MIM 188390
UniProt ID P06454

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTMA Products

Required fields are marked with *

My Review for All PTMA Products

Required fields are marked with *

0
cart-icon
0
compare icon