Recombinant Human Full Length VKORC1 Protein, Flag tagged

Cat.No. : VKORC1-14HFL
Product Overview : Recombinant full length protein of human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2 with Flag tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293T
Tag : Flag
Protein Length : 1-163 aa
Description : This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants.
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Molecular Mass : 9.7 kDa
AASequence : MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGVSRWFCLPGLDPVLRALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage : Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Concentration : >0.05 μg/μL as determined by microplate BCA method
Gene Name VKORC1 vitamin K epoxide reductase complex subunit 1 [ Homo sapiens (human) ]
Official Symbol VKORC1
Synonyms VKORC1; vitamin K epoxide reductase complex, subunit 1; vitamin K dependent clotting factors deficiency 2, VKCFD2; vitamin K epoxide reductase complex subunit 1; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K dependent clotting factors deficiency 2; vitamin K1 epoxide reductase (warfarin-sensitive); VKOR; MST134; MST576; VKCFD2; EDTP308; IMAGE3455200; MGC2694; FLJ00289
Gene ID 79001
mRNA Refseq NM_206824
Protein Refseq NP_996560
MIM 608547
UniProt ID Q9BQB6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VKORC1 Products

Required fields are marked with *

My Review for All VKORC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon