Recombinant Human FUNDC1 protein, GST-tagged
Cat.No. : | FUNDC1-7232H |
Product Overview : | Recombinant Human FUNDC1 protein(96-155 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 96-155 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | FUNDC1 |
Synonyms | FUNDC1; FUN14 domain containing 1; FUN14 domain-containing protein 1; MGC51029; |
Gene ID | 139341 |
mRNA Refseq | NM_173794 |
Protein Refseq | NP_776155 |
UniProt ID | Q8IVP5 |
◆ Recombinant Proteins | ||
RFL27849XF | Recombinant Full Length Xenopus Tropicalis Fun14 Domain-Containing Protein 1(Fundc1) Protein, His-Tagged | +Inquiry |
RFL78BF | Recombinant Full Length Bovine Fun14 Domain-Containing Protein 1(Fundc1) Protein, His-Tagged | +Inquiry |
FUNDC1-4711C | Recombinant Chicken FUNDC1 | +Inquiry |
FUNDC1-4549H | Recombinant Human FUNDC1 Protein, GST-tagged | +Inquiry |
FUNDC1-2409R | Recombinant Rat FUNDC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUNDC1-6121HCL | Recombinant Human FUNDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUNDC1 Products
Required fields are marked with *
My Review for All FUNDC1 Products
Required fields are marked with *
0
Inquiry Basket