Recombinant Human FUT1 Protein, GST-tagged
Cat.No. : | FUT1-4557H |
Product Overview : | Human FUT1 full-length ORF ( NP_000139.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq |
Molecular Mass : | 67.7 kDa |
AA Sequence : | MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) [ Homo sapiens ] |
Official Symbol | FUT1 |
Synonyms | FUT1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase), fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase, Bombay phenotype included), H, HSC; galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); H; HH; HSC; |
Gene ID | 2523 |
mRNA Refseq | NM_000148 |
Protein Refseq | NP_000139 |
MIM | 211100 |
UniProt ID | P19526 |
◆ Recombinant Proteins | ||
FUT1-1589R | Recombinant Rhesus Macaque FUT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT1-2067R | Recombinant Rat FUT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT1-24H | Active Recombinant Human FUT1 Protein (AA 26-365), N-6×His/GFP tagged | +Inquiry |
FUT1-4559H | Recombinant Human FUT1 Protein, His-tagged | +Inquiry |
FUT1-5173HF | Recombinant Full Length Human FUT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT1-6117HCL | Recombinant Human FUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT1 Products
Required fields are marked with *
My Review for All FUT1 Products
Required fields are marked with *