Recombinant Human FUT1 Protein, GST-tagged

• Cat.No.: FUT1-4557H
• Product Overview: Human FUT1 full-length ORF ( NP_000139.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq
• Molecular Mass: 67.7 kDa
• AA Sequence: MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) [ Homo sapiens ]
• Official Symbol: FUT1
• Synonyms: FUT1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase), fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase, Bombay phenotype included), H, HSC; galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); H; HH; HSC
• Gene ID: 2523
• mRNA Refseq: NM_000148
• Protein Refseq: NP_000139
• MIM: 211100
• UniProt ID: P19526