Recombinant Human FUT10 Protein, GST-tagged
Cat.No. : | FUT10-4558H |
Product Overview : | Human FUT10 full-length ORF ( AAH04884, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FUT10 (Fucosyltransferase 10) is a Protein Coding gene. GO annotations related to this gene include fucosyltransferase activity and alpha-(1->3)-fucosyltransferase activity. An important paralog of this gene is FUT11. |
Molecular Mass : | 35.86 kDa |
AA Sequence : | MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUT10 fucosyltransferase 10 (alpha (1,3) fucosyltransferase) [ Homo sapiens ] |
Official Symbol | FUT10 |
Synonyms | FUT10; fucosyltransferase 10 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase 10; fuc-TX; fucT-X; fucosyltransferase X; alpha 1,3-fucosyl transferase; galactoside 3-L-fucosyltransferase 10; MGC11141; |
Gene ID | 84750 |
mRNA Refseq | NM_032664 |
Protein Refseq | NP_116053 |
MIM | 616931 |
UniProt ID | Q6P4F1 |
◆ Recombinant Proteins | ||
FUT10-6000C | Recombinant Chicken FUT10 | +Inquiry |
FUT10-2412R | Recombinant Rat FUT10 Protein | +Inquiry |
FUT10-2068R | Recombinant Rat FUT10 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT10-6090M | Recombinant Mouse FUT10 Protein | +Inquiry |
FUT10-4558H | Recombinant Human FUT10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT10-2490HCL | Recombinant Human FUT10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT10 Products
Required fields are marked with *
My Review for All FUT10 Products
Required fields are marked with *