Recombinant Human FUT10 Protein, GST-tagged

Cat.No. : FUT10-4558H
Product Overview : Human FUT10 full-length ORF ( AAH04884, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FUT10 (Fucosyltransferase 10) is a Protein Coding gene. GO annotations related to this gene include fucosyltransferase activity and alpha-(1->3)-fucosyltransferase activity. An important paralog of this gene is FUT11.
Molecular Mass : 35.86 kDa
AA Sequence : MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUT10 fucosyltransferase 10 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
Official Symbol FUT10
Synonyms FUT10; fucosyltransferase 10 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase 10; fuc-TX; fucT-X; fucosyltransferase X; alpha 1,3-fucosyl transferase; galactoside 3-L-fucosyltransferase 10; MGC11141;
Gene ID 84750
mRNA Refseq NM_032664
Protein Refseq NP_116053
MIM 616931
UniProt ID Q6P4F1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT10 Products

Required fields are marked with *

My Review for All FUT10 Products

Required fields are marked with *

0
cart-icon
0
compare icon