Recombinant Human FUT11 protein, His-tagged
| Cat.No. : | FUT11-2454H |
| Product Overview : | Recombinant Human FUT11 protein(143-492 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 143-492 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLSLQWLPGTAYLRRPVPPPMERAEWRRRGYAPLLYLQSHCDVPADRDRYVRELMRHIPVDSYGKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICNDYMTEKLWRPMHLGAVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIAQPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYLHEIFMKRQHL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FUT11 fucosyltransferase 11 (alpha (1,3) fucosyltransferase) [ Homo sapiens ] |
| Official Symbol | FUT11 |
| Synonyms | FUT11; fucosyltransferase 11 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase 11; MGC33202; fuc-TXI; fucT-XI; fucosyltransferase XI; galactoside 3-L-fucosyltransferase 11; MGC119338; MGC119339; |
| Gene ID | 170384 |
| mRNA Refseq | NM_173540 |
| Protein Refseq | NP_775811 |
| UniProt ID | Q495W5 |
| ◆ Recombinant Proteins | ||
| FUT11-2069R | Recombinant Rat FUT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FUT11-2985H | Recombinant Human FUT11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FUT11-2413R | Recombinant Rat FUT11 Protein | +Inquiry |
| Fut11-3109M | Recombinant Mouse Fut11 Protein, Myc/DDK-tagged | +Inquiry |
| FUT11-327H | Active Recombinant Human FUT11, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUT11-6116HCL | Recombinant Human FUT11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT11 Products
Required fields are marked with *
My Review for All FUT11 Products
Required fields are marked with *
