Recombinant Human FUT6 Protein (AA 40-359), N-6×His/GFP tagged

• Cat.No.: FUT6-27H
• Product Overview: Recombinant Human FUT6 Protein (AA 40-359) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: AA 40-359
• Description: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.
• Molecular Mass: ~70 kDa
• AA Sequence: DPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSSRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFKNSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) [ Homo sapiens (human) ]
• Official Symbol: FUT6
• Synonyms: FUT6; fucosyltransferase 6 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; alpha (1; 3) fucosyltransferase; FCT3A; FLJ40754; FT1A; FucT VI; galactoside 3 L fucosyltransferase; fucosyltransferase VI; galactoside 3-L-fucosyltransferase; Fuc-TVI; FucT-VI
• Gene ID: 2528
• mRNA Refseq: NM_000150
• Protein Refseq: NP_000141
• MIM: 136836
• UniProt ID: P51993