Recombinant Human FUT6 Protein (AA 40-359), N-6×His/GFP tagged
Cat.No. : | FUT6-27H |
Product Overview : | Recombinant Human FUT6 Protein (AA 40-359) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 40-359 |
Description : | The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | ~70 kDa |
AA Sequence : | DPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSSRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFKNSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT |
Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | FUT6 fucosyltransferase 6 (alpha (1,3) fucosyltransferase) [ Homo sapiens (human) ] |
Official Symbol | FUT6 |
Synonyms | FUT6; fucosyltransferase 6 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; alpha (1; 3) fucosyltransferase; FCT3A; FLJ40754; FT1A; FucT VI; galactoside 3 L fucosyltransferase; fucosyltransferase VI; galactoside 3-L-fucosyltransferase; Fuc-TVI; FucT-VI; |
Gene ID | 2528 |
mRNA Refseq | NM_000150 |
Protein Refseq | NP_000141 |
MIM | 136836 |
UniProt ID | P51993 |
◆ Recombinant Proteins | ||
FUT6-13045H | Recombinant Human FUT6, GST-tagged | +Inquiry |
FUT6-5184HF | Recombinant Full Length Human FUT6 Protein, GST-tagged | +Inquiry |
FUT6-3289P | Recombinant Pan troglodytes (Chimpanzee) FUT6, His-tagged | +Inquiry |
FUT6-2326H | Recombinant Human FUT6 Protein (Arg35-Thr359), N-His tagged | +Inquiry |
RFL13091HF | Recombinant Full Length Human Alpha-(1,3)-Fucosyltransferase 6(Fut6) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT6-6113HCL | Recombinant Human FUT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT6 Products
Required fields are marked with *
My Review for All FUT6 Products
Required fields are marked with *
0
Inquiry Basket