Recombinant Full Length Human Alpha-(1,3)-Fucosyltransferase 6(Fut6) Protein, His-Tagged
Cat.No. : | RFL13091HF |
Product Overview : | Recombinant Full Length Human Alpha-(1,3)-fucosyltransferase 6(FUT6) Protein (P51993) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FUT6 |
Synonyms | FUT6; FCT3A; 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6; Fucosyltransferase 6; Fucosyltransferase VI; Fuc-TVI; FucT-VI; Galactoside 3-L-fucosyltransferase |
UniProt ID | P51993 |
◆ Recombinant Proteins | ||
FUT6-4565H | Recombinant Human FUT6 Protein, GST-tagged | +Inquiry |
FUT6-2326H | Recombinant Human FUT6 Protein (Arg35-Thr359), N-His tagged | +Inquiry |
RFL13091HF | Recombinant Full Length Human Alpha-(1,3)-Fucosyltransferase 6(Fut6) Protein, His-Tagged | +Inquiry |
FUT6-1412H | Recombinant Human FUT6 protein, His & T7-tagged | +Inquiry |
FUT6-3289P | Recombinant Pan troglodytes (Chimpanzee) FUT6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT6-6113HCL | Recombinant Human FUT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT6 Products
Required fields are marked with *
My Review for All FUT6 Products
Required fields are marked with *