Recombinant Human FUT7 Protein, GST-tagged
| Cat.No. : | FUT7-4566H |
| Product Overview : | Human FUT7 partial ORF ( NP_004470, 262 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq |
| Molecular Mass : | 34.65 kDa |
| AA Sequence : | YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FUT7 fucosyltransferase 7 (alpha (1,3) fucosyltransferase) [ Homo sapiens ] |
| Official Symbol | FUT7 |
| Synonyms | FUT7; fucosyltransferase 7 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; fuc-TVII; fucosyltransferase VII; selectin ligand synthase; selectin-ligand synthase; galactoside 3-L-fucosyltransferase; FucT-VII; |
| Gene ID | 2529 |
| mRNA Refseq | NM_004479 |
| Protein Refseq | NP_004470 |
| MIM | 602030 |
| UniProt ID | Q11130 |
| ◆ Recombinant Proteins | ||
| FUT7-131H | Recombinant Human FUT7, His-tagged | +Inquiry |
| FUT7-2988H | Recombinant Human FUT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fut7-4263M | Recombinant Mouse Fut7 protein, His-tagged | +Inquiry |
| Fut7-1227M | Recombinant Mouse Fut7 protein, GST-tagged | +Inquiry |
| Fut7-1302M | Recombinant Mouse Fut7 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUT7-6112HCL | Recombinant Human FUT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT7 Products
Required fields are marked with *
My Review for All FUT7 Products
Required fields are marked with *
