Recombinant Human FUT8 protein, GST-tagged
Cat.No. : | FUT8-8966H |
Product Overview : | Recombinant Human FUT8 protein(340-450 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 340-450 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | PWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | FUT8 fucosyltransferase 8 (alpha (1,6) fucosyltransferase) [ Homo sapiens ] |
Official Symbol | FUT8 |
Synonyms | FUT8; fucosyltransferase 8 (alpha (1,6) fucosyltransferase); alpha-(1,6)-fucosyltransferase; alpha1-6FucT; glycoprotein 6-alpha-L-fucosyltransferase; GDP-fucose--glycoprotein fucosyltransferase; GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase; MGC26465; |
mRNA Refseq | NM_004480 |
Protein Refseq | NP_004471 |
MIM | 602589 |
UniProt ID | Q9BYC5 |
Gene ID | 2530 |
◆ Recombinant Proteins | ||
FUT8-2071R | Recombinant Rat FUT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT8-577H | Active Recombinant Human Fucosyltransferase 8 (alpha (1, 6) fucosyltransferase), His-tagged | +Inquiry |
FUT8-8966H | Recombinant Human FUT8 protein, GST-tagged | +Inquiry |
FUT8-1590R | Recombinant Rhesus Macaque FUT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT8-518H | Recombinant Human FUT8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT8-497HCL | Recombinant Human FUT8 cell lysate | +Inquiry |
FUT8-001HCL | Recombinant Hamster FUT8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT8 Products
Required fields are marked with *
My Review for All FUT8 Products
Required fields are marked with *