Recombinant Human FXN protein, His-SUMO & Myc-tagged
Cat.No. : | FXN-4372H |
Product Overview : | Recombinant Human FXN protein(Q16595)(1-210aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-210aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FXN frataxin [ Homo sapiens ] |
Official Symbol | FXN |
Synonyms | FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199; |
Gene ID | 2395 |
mRNA Refseq | NM_000144 |
Protein Refseq | NP_000135 |
MIM | 606829 |
UniProt ID | Q16595 |
◆ Recombinant Proteins | ||
FxN-4373H | Recombinant Human FxN protein, His&Myc-tagged | +Inquiry |
Fxn-2934R | Recombinant Rat Fxn protein | +Inquiry |
FXN-3398M | Recombinant Mouse FXN Protein, His (Fc)-Avi-tagged | +Inquiry |
Fxn-1218R | Recombinant Rat Fxn Protein, His-tagged | +Inquiry |
FXN-3162H | Recombinant Human FXN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXN Products
Required fields are marked with *
My Review for All FXN Products
Required fields are marked with *
0
Inquiry Basket