Recombinant Cynomolgus monkey FXN protein, His-tagged
Cat.No. : | FXN-4617C |
Product Overview : | Recombinant Cynomolgus monkey FXN protein(Q8HXX9)(81-210aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-210aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Fxn-2934R | Recombinant Rat Fxn protein | +Inquiry |
FXN-13051H | Recombinant Human FXN, His-tagged | +Inquiry |
FXN-4372H | Recombinant Human FXN protein, His-SUMO & Myc-tagged | +Inquiry |
FXN-4617C | Recombinant Cynomolgus monkey FXN protein, His-tagged | +Inquiry |
FXN-1592R | Recombinant Rhesus Macaque FXN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXN Products
Required fields are marked with *
My Review for All FXN Products
Required fields are marked with *
0
Inquiry Basket