Recombinant Human FXYD2 Protein (1-64 aa), GST-tagged
Cat.No. : | FXYD2-2139H |
Product Overview : | Recombinant Human FXYD2 Protein (1-64 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-64 aa |
Description : | May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.4 kDa |
AA Sequence : | MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens ] |
Official Symbol | FXYD2 |
Synonyms | FXYD2; MGC12372; sodium pump gamma chain; HOMG2; ATP1G1; |
Gene ID | 486 |
mRNA Refseq | NM_001680 |
Protein Refseq | NP_001671 |
MIM | 601814 |
UniProt ID | P54710 |
◆ Cell & Tissue Lysates | ||
FXYD2-6103HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
FXYD2-6102HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD2 Products
Required fields are marked with *
My Review for All FXYD2 Products
Required fields are marked with *