Recombinant Human FXYD2 Protein (1-64 aa), GST-tagged

• Cat.No.: FXYD2-2139H
• Product Overview: Recombinant Human FXYD2 Protein (1-64 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-64 aa
• Description: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.4 kDa
• AA Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens ]
• Official Symbol: FXYD2
• Synonyms: FXYD2; MGC12372; sodium pump gamma chain; HOMG2; ATP1G1
• Gene ID: 486
• mRNA Refseq: NM_001680
• Protein Refseq: NP_001671
• MIM: 601814
• UniProt ID: P54710