Recombinant Human FXYD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FXYD2-3531H |
Product Overview : | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus. |
Molecular Mass : | 7.4 kDa |
AA Sequence : | MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens (human) ] |
Official Symbol | FXYD2 |
Synonyms | FXYD2; FXYD domain containing ion transport regulator 2; ATP1G1, HOMG2, hypomagnesemia 2, renal; sodium/potassium-transporting ATPase subunit gamma; MGC12372; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; HOMG2; ATP1G1; |
Gene ID | 486 |
mRNA Refseq | NM_021603 |
Protein Refseq | NP_067614 |
MIM | 601814 |
UniProt ID | P54710 |
◆ Recombinant Proteins | ||
RFL21318HF | Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Gamma(Fxyd2) Protein, His-Tagged | +Inquiry |
FXYD2-5278HF | Recombinant Full Length Human FXYD2 Protein, GST-tagged | +Inquiry |
FXYD2-2809H | Recombinant Human FXYD2 Protein, His-tagged, BSA Conjugated | +Inquiry |
FXYD2-2077R | Recombinant Rat FXYD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FXYD2-6104M | Recombinant Mouse FXYD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD2-6102HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
FXYD2-6103HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD2 Products
Required fields are marked with *
My Review for All FXYD2 Products
Required fields are marked with *