Recombinant Human FXYD3 Protein, GST-tagged

Cat.No. : FXYD3-4580H
Product Overview : Human FXYD3 full-length ORF ( AAH05238, 21 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Molecular Mass : 33.11 kDa
AA Sequence : NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ]
Official Symbol FXYD3
Synonyms FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3, PLML; FXYD domain-containing ion transport regulator 3; MAT 8; phospholemman-like protein; mammary tumor 8 kDa protein; chloride conductance inducer protein Mat-8; MAT8; PLML; MGC111076;
Gene ID 5349
mRNA Refseq NM_001136007
Protein Refseq NP_001129479
MIM 604996
UniProt ID Q14802

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXYD3 Products

Required fields are marked with *

My Review for All FXYD3 Products

Required fields are marked with *

0
cart-icon