Recombinant Human FXYD3 Protein, GST-tagged
Cat.No. : | FXYD3-4580H |
Product Overview : | Human FXYD3 full-length ORF ( AAH05238, 21 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms |
Molecular Mass : | 33.11 kDa |
AA Sequence : | NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ] |
Official Symbol | FXYD3 |
Synonyms | FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3, PLML; FXYD domain-containing ion transport regulator 3; MAT 8; phospholemman-like protein; mammary tumor 8 kDa protein; chloride conductance inducer protein Mat-8; MAT8; PLML; MGC111076; |
Gene ID | 5349 |
mRNA Refseq | NM_001136007 |
Protein Refseq | NP_001129479 |
MIM | 604996 |
UniProt ID | Q14802 |
◆ Recombinant Proteins | ||
FXYD3-4580H | Recombinant Human FXYD3 Protein, GST-tagged | +Inquiry |
FXYD3-2928H | Recombinant Human FXYD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FXYD3-2078R | Recombinant Rat FXYD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FXYD3-172HF | Recombinant Full Length Human FXYD3 Protein | +Inquiry |
FXYD3-1355H | Recombinant Human FXYD3, MYC&DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
FXYD3-6100HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD3 Products
Required fields are marked with *
My Review for All FXYD3 Products
Required fields are marked with *
0
Inquiry Basket