Recombinant Human FXYD3 Protein, GST-tagged
| Cat.No. : | FXYD3-4580H |
| Product Overview : | Human FXYD3 full-length ORF ( AAH05238, 21 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms |
| Molecular Mass : | 33.11 kDa |
| AA Sequence : | NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ] |
| Official Symbol | FXYD3 |
| Synonyms | FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3, PLML; FXYD domain-containing ion transport regulator 3; MAT 8; phospholemman-like protein; mammary tumor 8 kDa protein; chloride conductance inducer protein Mat-8; MAT8; PLML; MGC111076; |
| Gene ID | 5349 |
| mRNA Refseq | NM_001136007 |
| Protein Refseq | NP_001129479 |
| MIM | 604996 |
| UniProt ID | Q14802 |
| ◆ Recombinant Proteins | ||
| FXYD3-2928H | Recombinant Human FXYD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FXYD3-1353H | Recombinant Human FXYD3, MYC&DDK-tagged | +Inquiry |
| FXYD3-26269TH | Recombinant Human FXYD3 | +Inquiry |
| FXYD3-5279HF | Recombinant Full Length Human FXYD3 Protein, GST-tagged | +Inquiry |
| Fxyd3-3114M | Recombinant Mouse Fxyd3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
| FXYD3-6100HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD3 Products
Required fields are marked with *
My Review for All FXYD3 Products
Required fields are marked with *



