Recombinant Human FXYD3
| Cat.No. : | FXYD3-26269TH |
| Product Overview : | Recombinant full length Human FXDY3 with N terminal proprietary tag; Predicted MWt 33.48 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 67 amino acids |
| Description : | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Molecular Weight : | 33.480kDa inclusive of tags |
| Tissue specificity : | Expressed in a subset of human breast tumors. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS |
| Sequence Similarities : | Belongs to the FXYD family. |
| Gene Name | FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ] |
| Official Symbol | FXYD3 |
| Synonyms | FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3 , PLML; FXYD domain-containing ion transport regulator 3; MAT 8; |
| Gene ID | 5349 |
| mRNA Refseq | NM_001136007 |
| Protein Refseq | NP_001129479 |
| MIM | 604996 |
| Uniprot ID | Q14802 |
| Chromosome Location | 19q13.11-q13.12 |
| Function | ATPase binding; chloride channel activity; ion channel activity; |
| ◆ Recombinant Proteins | ||
| FXYD3-4580H | Recombinant Human FXYD3 Protein, GST-tagged | +Inquiry |
| FXYD3-1354H | Recombinant Human FXYD3, MYC&DDK-tagged | +Inquiry |
| FXYD3-13056H | Recombinant Human FXYD3, His-tagged | +Inquiry |
| RFL32568SF | Recombinant Full Length Pig Fxyd Domain-Containing Ion Transport Regulator 3(Fxyd3) Protein, His-Tagged | +Inquiry |
| FXYD3-4429H | Recombinant Human FXYD3 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
| FXYD3-6100HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD3 Products
Required fields are marked with *
My Review for All FXYD3 Products
Required fields are marked with *




