Recombinant Human FXYD4 Protein, Flag-tagged
| Cat.No. : | FXYD4-1376H |
| Product Overview : | Recombinant Human FXYD4 Protein is produced by HEK293T expression system. This protein is fused with a Flag tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Flag |
| Description : | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found. |
| Form : | PBS buffer |
| Molecular Mass : | 9 kDa |
| AA Sequence : | MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | FXYD4 FXYD domain containing ion transport regulator 4 [ Homo sapiens ] |
| Official Symbol | FXYD4 |
| Synonyms | CHIF |
| Gene ID | 53828 |
| mRNA Refseq | NM_173160.2 |
| Protein Refseq | NP_775183.1 |
| UniProt ID | P59646 |
| ◆ Recombinant Proteins | ||
| FXYD4-6106M | Recombinant Mouse FXYD4 Protein | +Inquiry |
| FXYD4-2423R | Recombinant Rat FXYD4 Protein | +Inquiry |
| Fxyd4-354M | Recombinant Mouse Fxyd4 Protein, MYC/DDK-tagged | +Inquiry |
| FXYD4-3402M | Recombinant Mouse FXYD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL15645HF | Recombinant Full Length Human Fxyd Domain-Containing Ion Transport Regulator 4(Fxyd4) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXYD4-6099HCL | Recombinant Human FXYD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD4 Products
Required fields are marked with *
My Review for All FXYD4 Products
Required fields are marked with *
