Recombinant Human FXYD4 Protein, Flag-tagged

Cat.No. : FXYD4-1376H
Product Overview : Recombinant Human FXYD4 Protein is produced by HEK293T expression system. This protein is fused with a Flag tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Description : This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.
Form : PBS buffer
Molecular Mass : 9 kDa
AA Sequence : MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Gene Name FXYD4 FXYD domain containing ion transport regulator 4 [ Homo sapiens ]
Official Symbol FXYD4
Synonyms CHIF
Gene ID 53828
mRNA Refseq NM_173160.2
Protein Refseq NP_775183.1
UniProt ID P59646

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXYD4 Products

Required fields are marked with *

My Review for All FXYD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon