Recombinant Human FZD3 Protein, GST-tagged
| Cat.No. : | FZD3-12H |
| Product Overview : | Recombinant Human FZD3(55 a.a. - 157 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 55 a.a. - 157 a.a. |
| Description : | This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.07kDa |
| AA Sequence : | QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | FZD3 frizzled family receptor 3 [ Homo sapiens ] |
| Official Symbol | FZD3 |
| Synonyms | FZD3; frizzled family receptor 3; frizzled (Drosophila) homolog 3 , frizzled 3, seven transmembrane spanning receptor , frizzled homolog 3 (Drosophila); frizzled-3; frizzled homolog 3; frizzled 3, seven transmembrane spanning receptor; Fz-3; |
| Gene ID | 7976 |
| mRNA Refseq | NM_017412 |
| Protein Refseq | NP_059108 |
| MIM | 606143 |
| UniProt ID | Q9NPG1 |
| ◆ Recombinant Proteins | ||
| FZD3-13066H | Recombinant Human FZD3, GST-tagged | +Inquiry |
| FZD3-0294H | Recombinant Human FZD3 Full Length Transmembrane protein, His-tagged | +Inquiry |
| FZD3-1082HF | Recombinant Full Length Human FZD3 Protein, GST-tagged | +Inquiry |
| RFL19095XF | Recombinant Full Length Xenopus Laevis Frizzled-3(Fzd3) Protein, His-Tagged | +Inquiry |
| RFL16362HF | Recombinant Full Length Human Frizzled-3(Fzd3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD3 Products
Required fields are marked with *
My Review for All FZD3 Products
Required fields are marked with *
