Recombinant Human FZD4 Protein, C-His-tagged
Cat.No. : | FZD4-147H |
Product Overview : | Recombinant Human FZD4 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Frizzled-4 is a 537 amino acid protein encoded by the human gene FZD4. Frizzled-4 acts as a receptor for Wnt proteins. Most frizzled receptors are coupled to the b-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of b-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Frizzled-4 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Frizzled-4 also plays a critical role in retinal angiogenesis. Frizzled-4 is virtually ubiquitously expressed with greatest amounts found in adult heart, skeletal muscle, ovary, and fetal kidney |
Molecular Mass : | ~19 kDa |
AA Sequence : | FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYS |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | FZD4 frizzled family receptor 4 [ Homo sapiens (human) ] |
Official Symbol | FZD4 |
Synonyms | FZD4; frizzled family receptor 4; EVR1, exudative vitreoretinopathy 1 , frizzled (Drosophila) homolog 4 , frizzled 4, seven transmembrane spanning receptor , frizzled homolog 4 (Drosophila); frizzled-4; CD344; hFz4; frizzled homolog 4; WNT receptor frizzled-4; frizzled 4, seven transmembrane spanning receptor; EVR1; FEVR; Fz-4; FzE4; GPCR; FZD4S; MGC34390; |
Gene ID | 8322 |
mRNA Refseq | NM_012193 |
Protein Refseq | NP_036325 |
MIM | 604579 |
UniProt ID | Q9ULV1 |
◆ Recombinant Proteins | ||
FZD4-5675C | Recombinant Chicken FZD4 | +Inquiry |
FZD4-147H | Recombinant Human FZD4 Protein, C-His-tagged | +Inquiry |
FZD4-1766R | Recombinant Rhesus Monkey FZD4 Protein, hIgG4-tagged | +Inquiry |
FZD4-1540H | Recombinant Human FZD4 Protein, His-tagged | +Inquiry |
FZD4-1469H | Recombinant Human FZD4 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD4-1196RCL | Recombinant Rat FZD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD4 Products
Required fields are marked with *
My Review for All FZD4 Products
Required fields are marked with *
0
Inquiry Basket