Recombinant Human FZD4 Protein, C-His-tagged

Cat.No. : FZD4-147H
Product Overview : Recombinant Human FZD4 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Frizzled-4 is a 537 amino acid protein encoded by the human gene FZD4. Frizzled-4 acts as a receptor for Wnt proteins. Most frizzled receptors are coupled to the b-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of b-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Frizzled-4 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Frizzled-4 also plays a critical role in retinal angiogenesis. Frizzled-4 is virtually ubiquitously expressed with greatest amounts found in adult heart, skeletal muscle, ovary, and fetal kidney
Molecular Mass : ~19 kDa
AA Sequence : FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name FZD4 frizzled family receptor 4 [ Homo sapiens (human) ]
Official Symbol FZD4
Synonyms FZD4; frizzled family receptor 4; EVR1, exudative vitreoretinopathy 1 , frizzled (Drosophila) homolog 4 , frizzled 4, seven transmembrane spanning receptor , frizzled homolog 4 (Drosophila); frizzled-4; CD344; hFz4; frizzled homolog 4; WNT receptor frizzled-4; frizzled 4, seven transmembrane spanning receptor; EVR1; FEVR; Fz-4; FzE4; GPCR; FZD4S; MGC34390;
Gene ID 8322
mRNA Refseq NM_012193
Protein Refseq NP_036325
MIM 604579
UniProt ID Q9ULV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD4 Products

Required fields are marked with *

My Review for All FZD4 Products

Required fields are marked with *

0
cart-icon