Recombinant Human FZD6 Protein, His-Avi-tagged, biotinylated
Cat.No. : | FZD6-739HB |
Product Overview : | Biotinylated Recombinant Human FZD6 Protein(Met1-Val153), fused with His and Avi tag, was expressed in HEK293. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Tag : | Avi&His |
Protein Length : | Met1-Val153 |
Tag : | His-Avi |
Form : | Lyophilized from PBS, pH 7.4, 5% trehalose, 5% mannitol. |
Molecular Mass : | The protein has a calculated MW of 18.9 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | >95% as determined by reduced SDS-PAGE. |
Storage : | For long term storage, the product should be stored at lyophilized state at -20°C or lower. Please avoid repeated freeze-thaw cycles. No activity loss is observed after storage at: 4-8°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVAHHHHHHHHHHGLNDIFEAQKIEWHE |
Gene Name | FZD6 frizzled family receptor 6 [ Homo sapiens ] |
Official Symbol | FZD6 |
Synonyms | FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6 , frizzled 6, seven transmembrane spanning receptor , frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10; |
Gene ID | 8323 |
mRNA Refseq | NM_001164615 |
Protein Refseq | NP_001158087 |
MIM | 603409 |
UniProt ID | O60353 |
◆ Recombinant Proteins | ||
FZD6-4682C | Recombinant Chicken FZD6 | +Inquiry |
RFL33663CF | Recombinant Full Length Dog Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
RFL8952MF | Recombinant Full Length Mouse Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
FZD6-10841Z | Recombinant Zebrafish FZD6 | +Inquiry |
FZD6-3017H | Recombinant Human FZD6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD6-6089HCL | Recombinant Human FZD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD6 Products
Required fields are marked with *
My Review for All FZD6 Products
Required fields are marked with *