Recombinant Human FZD6 Protein, His-Avi-tagged, biotinylated
| Cat.No. : | FZD6-739HB |
| Product Overview : | Biotinylated Recombinant Human FZD6 Protein(Met1-Val153), fused with His and Avi tag, was expressed in HEK293. |
| Availability | November 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | Avi&His |
| Protein Length : | Met1-Val153 |
| Tag : | His-Avi |
| Form : | Lyophilized from PBS, pH 7.4, 5% trehalose, 5% mannitol. |
| Molecular Mass : | The protein has a calculated MW of 18.9 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | >95% as determined by reduced SDS-PAGE. |
| Storage : | For long term storage, the product should be stored at lyophilized state at -20°C or lower. Please avoid repeated freeze-thaw cycles. No activity loss is observed after storage at: 4-8°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVAHHHHHHHHHHGLNDIFEAQKIEWHE |
| Conjugation : | Biotin |
| Gene Name | FZD6 frizzled family receptor 6 [ Homo sapiens ] |
| Official Symbol | FZD6 |
| Synonyms | FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6 , frizzled 6, seven transmembrane spanning receptor , frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10; |
| Gene ID | 8323 |
| mRNA Refseq | NM_001164615 |
| Protein Refseq | NP_001158087 |
| MIM | 603409 |
| UniProt ID | O60353 |
| ◆ Cell & Tissue Lysates | ||
| FZD6-6089HCL | Recombinant Human FZD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD6 Products
Required fields are marked with *
My Review for All FZD6 Products
Required fields are marked with *
