Recombinant Human FZD6 Protein, His-Avi-tagged, biotinylated

• Cat.No.: FZD6-739HB
• Product Overview: Biotinylated Recombinant Human FZD6 Protein(Met1-Val153), fused with His and Avi tag, was expressed in HEK293.

Specification

• Tag: Avi&His
• Protein Length: Met1-Val153
• Tag: His-Avi
• Form: Lyophilized from PBS, pH 7.4, 5% trehalose, 5% mannitol.
• Molecular Mass: The protein has a calculated MW of 18.9 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: >95% as determined by reduced SDS-PAGE.
• Storage: For long term storage, the product should be stored at lyophilized state at -20°C or lower. Please avoid repeated freeze-thaw cycles. No activity loss is observed after storage at: 4-8°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVAHHHHHHHHHHGLNDIFEAQKIEWHE
• Conjugation: Biotin

Gene Information

• Gene Name: FZD6 frizzled family receptor 6 [ Homo sapiens ]
• Official Symbol: FZD6
• Synonyms: FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6 , frizzled 6, seven transmembrane spanning receptor , frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10
• Gene ID: 8323
• mRNA Refseq: NM_001164615
• Protein Refseq: NP_001158087
• MIM: 603409
• UniProt ID: O60353