Recombinant Human FZD6 Protein, His-Avi-tagged, biotinylated

Cat.No. : FZD6-739HB
Product Overview : Biotinylated Recombinant Human FZD6 Protein(Met1-Val153), fused with His and Avi tag, was expressed in HEK293.
Availability September 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Tag : Avi&His
Protein Length : Met1-Val153
Tag : His-Avi
Form : Lyophilized from PBS, pH 7.4, 5% trehalose, 5% mannitol.
Molecular Mass : The protein has a calculated MW of 18.9 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : >95% as determined by reduced SDS-PAGE.
Storage : For long term storage, the product should be stored at lyophilized state at -20°C or lower. Please avoid repeated freeze-thaw cycles. No activity loss is observed after storage at: 4-8°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVAHHHHHHHHHHGLNDIFEAQKIEWHE
Conjugation : Biotin
Gene Name FZD6 frizzled family receptor 6 [ Homo sapiens ]
Official Symbol FZD6
Synonyms FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6 , frizzled 6, seven transmembrane spanning receptor , frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10;
Gene ID 8323
mRNA Refseq NM_001164615
Protein Refseq NP_001158087
MIM 603409
UniProt ID O60353

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD6 Products

Required fields are marked with *

My Review for All FZD6 Products

Required fields are marked with *

0
cart-icon