Recombinant Human FZD6 protein, His-tagged
Cat.No. : | FZD6-3017H |
Product Overview : | Recombinant Human FZD6 protein(27-182 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-182 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FZD6 frizzled family receptor 6 [ Homo sapiens ] |
Official Symbol | FZD6 |
Synonyms | FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6 , frizzled 6, seven transmembrane spanning receptor , frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10; |
Gene ID | 8323 |
mRNA Refseq | NM_001164615 |
Protein Refseq | NP_001158087 |
MIM | 603409 |
UniProt ID | O60353 |
◆ Recombinant Proteins | ||
FZD6-1673H | Recombinant Human FZD6 protein, GST-tagged | +Inquiry |
FZD6-1777R | Recombinant Rhesus monkey FZD6 Protein, His-tagged | +Inquiry |
RFL21911GF | Recombinant Full Length Chicken Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
RFL8952MF | Recombinant Full Length Mouse Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
FZD6-13069H | Recombinant Human FZD6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD6-6089HCL | Recombinant Human FZD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD6 Products
Required fields are marked with *
My Review for All FZD6 Products
Required fields are marked with *
0
Inquiry Basket