Recombinant Human FZD7
Cat.No. : | FZD7-26288TH |
Product Overview : | Recombinant fragment of Human Frizzled 7 with a proprietary tag: predicted molecular weight 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas. |
Biological activity : | This product is useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA |
Sequence Similarities : | Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain. |
Gene Name | FZD7 frizzled family receptor 7 [ Homo sapiens ] |
Official Symbol | FZD7 |
Synonyms | FZD7; frizzled family receptor 7; frizzled (Drosophila) homolog 7 , frizzled 7, seven transmembrane spanning receptor , frizzled homolog 7 (Drosophila); frizzled-7; FzE3; |
Gene ID | 8324 |
mRNA Refseq | NM_003507 |
Protein Refseq | NP_003498 |
MIM | 603410 |
Uniprot ID | O75084 |
Chromosome Location | 2q33 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; |
Function | G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; receptor activity; |
◆ Recombinant Proteins | ||
FZD7-1470H | Recombinant Human FZD7 protein(Gln33-Arg254), hFc-tagged | +Inquiry |
FZD7-26288TH | Recombinant Human FZD7 | +Inquiry |
FZD7-537H | Active Recombinant Human FZD7 Protein, Fc-tagged | +Inquiry |
RFL2311HF | Recombinant Full Length Human Frizzled-7(Fzd7) Protein, His-Tagged | +Inquiry |
RFL20929MF | Recombinant Full Length Mouse Frizzled-7(Fzd7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD7 Products
Required fields are marked with *
My Review for All FZD7 Products
Required fields are marked with *
0
Inquiry Basket