Recombinant Human FZD7
| Cat.No. : | FZD7-26288TH |
| Product Overview : | Recombinant fragment of Human Frizzled 7 with a proprietary tag: predicted molecular weight 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas. |
| Biological activity : | This product is useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA |
| Sequence Similarities : | Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain. |
| Gene Name | FZD7 frizzled family receptor 7 [ Homo sapiens ] |
| Official Symbol | FZD7 |
| Synonyms | FZD7; frizzled family receptor 7; frizzled (Drosophila) homolog 7 , frizzled 7, seven transmembrane spanning receptor , frizzled homolog 7 (Drosophila); frizzled-7; FzE3; |
| Gene ID | 8324 |
| mRNA Refseq | NM_003507 |
| Protein Refseq | NP_003498 |
| MIM | 603410 |
| Uniprot ID | O75084 |
| Chromosome Location | 2q33 |
| Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; |
| Function | G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| FZD7-6121M | Recombinant Mouse FZD7 Protein | +Inquiry |
| FZD7-2704H | Active Recombinant Human FZD7 protein, hFc&His-tagged | +Inquiry |
| FZD7-384H | Active Recombinant Human FZD7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| FZD7-2166H | Recombinant Human FZD7 Protein, GST-tagged | +Inquiry |
| FZD7-6193HF | Recombinant Full Length Human FZD7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD7 Products
Required fields are marked with *
My Review for All FZD7 Products
Required fields are marked with *
