Recombinant Human FZD8 Protein, GST-tagged

Cat.No. : FZD8-4600H
Product Overview : Human FZD8 partial ORF ( NP_114072, 72 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined. [provided by RefSeq
Molecular Mass : 35.64 kDa
AA Sequence : FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FZD8 frizzled family receptor 8 [ Homo sapiens ]
Official Symbol FZD8
Synonyms FZD8; frizzled family receptor 8; frizzled (Drosophila) homolog 8, frizzled 8, seven transmembrane spanning receptor, frizzled homolog 8 (Drosophila); frizzled-8; frizzled homolog 8; frizzled 8, seven transmembrane spanning receptor; FZ-8; hFZ8;
Gene ID 8325
mRNA Refseq NM_031866
Protein Refseq NP_114072
MIM 606146
UniProt ID Q9H461

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD8 Products

Required fields are marked with *

My Review for All FZD8 Products

Required fields are marked with *

0
cart-icon
0
compare icon