Recombinant Human FZD8 Protein, GST-tagged
Cat.No. : | FZD8-4600H |
Product Overview : | Human FZD8 partial ORF ( NP_114072, 72 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined. [provided by RefSeq |
Molecular Mass : | 35.64 kDa |
AA Sequence : | FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FZD8 frizzled family receptor 8 [ Homo sapiens ] |
Official Symbol | FZD8 |
Synonyms | FZD8; frizzled family receptor 8; frizzled (Drosophila) homolog 8, frizzled 8, seven transmembrane spanning receptor, frizzled homolog 8 (Drosophila); frizzled-8; frizzled homolog 8; frizzled 8, seven transmembrane spanning receptor; FZ-8; hFZ8; |
Gene ID | 8325 |
mRNA Refseq | NM_031866 |
Protein Refseq | NP_114072 |
MIM | 606146 |
UniProt ID | Q9H461 |
◆ Recombinant Proteins | ||
RFL3704RF | Recombinant Full Length Rat Frizzled-8(Fzd8) Protein, His-Tagged | +Inquiry |
Fzd8-55M | Recombinant Mouse Fzd8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30853XF | Recombinant Full Length Xenopus Laevis Frizzled-8(Fzd8) Protein, His-Tagged | +Inquiry |
FZD8-6122M | Recombinant Mouse FZD8 Protein | +Inquiry |
FZD8-4600H | Recombinant Human FZD8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD8 Products
Required fields are marked with *
My Review for All FZD8 Products
Required fields are marked with *