Recombinant Human FZD9 Protein, C-His-tagged
Cat.No. : | FZD9-148H |
Product Overview : | Recombinant Human FZD9 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Receptor for WNT2 that is coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. Plays a role in neuromuscular junction (NMJ) assembly by negatively regulating the clustering of acetylcholine receptors (AChR) through the beta-catenin canonical signaling pathway. May play a role in neural progenitor cells (NPCs) viability through the beta-catenin canonical signaling pathway by negatively regulating cell cycle arrest leading to inhibition of neuron apoptotic process. During hippocampal development, regulates neuroblast proliferation and apoptotic cell death. Controls bone formation through non canonical Wnt signaling mediated via ISG15. Positively regulates bone regeneration through non canonical Wnt signaling (By similarity). |
Molecular Mass : | ~23 kDa |
AA Sequence : | LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKD |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | FZD9 frizzled family receptor 9 [ Homo sapiens (human) ] |
Official Symbol | FZD9 |
Synonyms | FZD9; frizzled family receptor 9; frizzled (Drosophila) homolog 9 , frizzled 9, seven transmembrane spanning receptor , frizzled homolog 9 (Drosophila); frizzled-9; CD349; FZD3; fz-9; fzE6; hFz9; frizzled homolog 9; frizzled 9, seven transmembrane spanning receptor; |
Gene ID | 8326 |
mRNA Refseq | NM_003508 |
Protein Refseq | NP_003499 |
MIM | 601766 |
UniProt ID | O00144 |
◆ Recombinant Proteins | ||
FZD9-6123M | Recombinant Mouse FZD9 Protein | +Inquiry |
FZD9-1768R | Recombinant Rhesus Monkey FZD9 Protein, hIgG1-tagged | +Inquiry |
FZD9-1767R | Recombinant Rhesus Monkey FZD9 Protein | +Inquiry |
RFL21633MF | Recombinant Full Length Mouse Frizzled-9(Fzd9) Protein, His-Tagged | +Inquiry |
FZD9-1138H | Recombinant Human FZD9 Protein (Leu23-Ala247), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD9 Products
Required fields are marked with *
My Review for All FZD9 Products
Required fields are marked with *
0
Inquiry Basket