Recombinant Human FZD9 protein, His-tagged
| Cat.No. : | FZD9-3809H |
| Product Overview : | Recombinant Human FZD9 protein(23-247 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 10, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-247 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENREKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FZD9 frizzled family receptor 9 [ Homo sapiens ] |
| Official Symbol | FZD9 |
| Synonyms | FZD9; frizzled family receptor 9; frizzled (Drosophila) homolog 9 , frizzled 9, seven transmembrane spanning receptor , frizzled homolog 9 (Drosophila); frizzled-9; CD349; FZD3; fz-9; fzE6; hFz9; frizzled homolog 9; frizzled 9, seven transmembrane spanning receptor; |
| Gene ID | 8326 |
| mRNA Refseq | NM_003508 |
| Protein Refseq | NP_003499 |
| MIM | 601766 |
| UniProt ID | O00144 |
| ◆ Recombinant Proteins | ||
| FZD9-4701C | Recombinant Chicken FZD9 | +Inquiry |
| FZD9-1767R | Recombinant Rhesus Monkey FZD9 Protein | +Inquiry |
| FZD9-1138H | Recombinant Human FZD9 Protein (Leu23-Ala247), N-His tagged | +Inquiry |
| RFL8653HF | Recombinant Full Length Human Frizzled-9(Fzd9) Protein, His-Tagged | +Inquiry |
| FZD9-1541H | Recombinant Human FZD9 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FZD9-168HKCL | Human FZD9 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD9 Products
Required fields are marked with *
My Review for All FZD9 Products
Required fields are marked with *
