Recombinant Human FZD9 protein, His-tagged
Cat.No. : | FZD9-3809H |
Product Overview : | Recombinant Human FZD9 protein(23-247 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-247 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENREKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FZD9 frizzled family receptor 9 [ Homo sapiens ] |
Official Symbol | FZD9 |
Synonyms | FZD9; frizzled family receptor 9; frizzled (Drosophila) homolog 9 , frizzled 9, seven transmembrane spanning receptor , frizzled homolog 9 (Drosophila); frizzled-9; CD349; FZD3; fz-9; fzE6; hFz9; frizzled homolog 9; frizzled 9, seven transmembrane spanning receptor; |
Gene ID | 8326 |
mRNA Refseq | NM_003508 |
Protein Refseq | NP_003499 |
MIM | 601766 |
UniProt ID | O00144 |
◆ Recombinant Proteins | ||
FZD9-13071H | Recombinant Human FZD9, GST-tagged | +Inquiry |
FZD9-3412M | Recombinant Mouse FZD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL16491GF | Recombinant Full Length Chicken Frizzled-9(Fzd9) Protein, His-Tagged | +Inquiry |
FZD9-1769R | Recombinant Rhesus Monkey FZD9 Protein, hIgG4-tagged | +Inquiry |
RFL21633MF | Recombinant Full Length Mouse Frizzled-9(Fzd9) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD9 Products
Required fields are marked with *
My Review for All FZD9 Products
Required fields are marked with *
0
Inquiry Basket