Recombinant Human GABARAPL1, His-tagged
Cat.No. : | GABARAPL1-26548TH |
Product Overview : | Recombinant full length Human GABARAPL1 with an N terminal His tag; 137aa, 16.2kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 117 amino acids |
Description : | Gamma-aminobutyric acid (GABA) receptor-associated protein-like 1, also known as GABARAPL1, belongs to the MAP1 LC3 family. |
Conjugation : | HIS |
Molecular Weight : | 16.200kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
Gene Name | GABARAPL1 GABA(A) receptor-associated protein like 1 [ Homo sapiens ] |
Official Symbol | GABARAPL1 |
Synonyms | GABARAPL1; GABA(A) receptor-associated protein like 1; gamma-aminobutyric acid receptor-associated protein-like 1; APG8L; ATG8B; ATG8L; gec1; |
Gene ID | 23710 |
mRNA Refseq | NM_031412 |
Protein Refseq | NP_113600 |
MIM | 607420 |
Uniprot ID | Q9H0R8 |
Chromosome Location | 12p13.31 |
Pathway | GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem; |
Function | GABA receptor binding; beta-tubulin binding; protein binding; |
◆ Recombinant Proteins | ||
GABARAPL1-4782H | Recombinant Human GABARAPL1 protein, GST-tagged | +Inquiry |
GABARAPL1-8655H | Recombinant Human GABARAPL1, His tagged | +Inquiry |
GABARAPL1-3422M | Recombinant Mouse GABARAPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAPL1-2441R | Recombinant Rat GABARAPL1 Protein | +Inquiry |
GABARAPL1-3385H | Recombinant Human GABARAPL1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABARAPL1 Products
Required fields are marked with *
My Review for All GABARAPL1 Products
Required fields are marked with *