Recombinant Human GABPB1
Cat.No. : | GABPB1-27461TH |
Product Overview : | Recombinant fragment of Human GABPB2, isoform 3 with N-terminal proprietary tag. Predicted MW 35.20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 87 amino acids |
Description : | This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Weight : | 35.200kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEVRSLLPGVLCRSHPK |
Sequence Similarities : | Contains 5 ANK repeats. |
Gene Name | GABPB1 GA binding protein transcription factor, beta subunit 1 [ Homo sapiens ] |
Official Symbol | GABPB1 |
Synonyms | GABPB1; GA binding protein transcription factor, beta subunit 1; GA binding protein transcription factor, beta subunit 2 , GABPB2; GA-binding protein subunit beta-1; E4TF1 47; GABPB; |
Gene ID | 2553 |
mRNA Refseq | NM_002041 |
Protein Refseq | NP_002032 |
MIM | 600610 |
Uniprot ID | Q06547 |
Chromosome Location | 15q21.2 |
Pathway | Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; |
Function | protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
GABPB1-05H | Recombinant Human GABPB1 Protein, N-His-tagged | +Inquiry |
GABPB1-06H | Recombinant Human GABPB1 Protein, N-His-tagged | +Inquiry |
GABPB1-27461TH | Recombinant Human GABPB1 | +Inquiry |
GABPB1-1612R | Recombinant Rhesus Macaque GABPB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABPB1-5260H | Recombinant Full Length Human GABPB1 Protein (1-395), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABPB1-6068HCL | Recombinant Human GABPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABPB1 Products
Required fields are marked with *
My Review for All GABPB1 Products
Required fields are marked with *
0
Inquiry Basket