Recombinant Human GABRA2 Protein, GST-tagged
Cat.No. : | GABRA2-390H |
Product Overview : | Recombinant Human GABRA2 Protein(348-412 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 348-412 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | GABRA2 |
Synonyms | GABRA2; gamma-aminobutyric acid (GABA) A receptor, alpha 2; gamma-aminobutyric acid receptor subunit alpha-2; GABA(A) receptor; alpha 2; GABA(A) receptor, alpha 2; GABA(A) receptor subunit alpha-2; FLJ97076; |
Gene ID | 2555 |
mRNA Refseq | NM_000807 |
Protein Refseq | NP_000798 |
MIM | 137140 |
UniProt ID | P47869 |
◆ Recombinant Proteins | ||
GABRA2-390H | Recombinant Human GABRA2 Protein, GST-tagged | +Inquiry |
GABRA2-1793R | Recombinant Rhesus monkey GABRA2 Protein, His-tagged | +Inquiry |
GABRA2-6145M | Recombinant Mouse GABRA2 Protein | +Inquiry |
GABRA2-3428M | Recombinant Mouse GABRA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRA2-1614R | Recombinant Rhesus Macaque GABRA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRA2-6066HCL | Recombinant Human GABRA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRA2 Products
Required fields are marked with *
My Review for All GABRA2 Products
Required fields are marked with *