Recombinant Human GABRA4 Protein (36-258 aa), His-SUMO-tagged

• Cat.No.: GABRA4-511H
• Product Overview: Recombinant Human GABRA4 Protein (36-258 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 36-258 aa
• Description: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 41.8 kDa
• AA Sequence: QNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: GABRA4 gamma-aminobutyric acid (GABA) A receptor, alpha 4 [ Homo sapiens ]
• Official Symbol: GABRA4
• Synonyms: GABRA4; alpha 4; GABA(A) receptor, alpha 4
• Gene ID: 2557
• mRNA Refseq: NM_000809
• Protein Refseq: NP_000800
• MIM: 137141
• UniProt ID: P48169