Recombinant Human GABRA4 Protein (36-258 aa), His-SUMO-tagged
Cat.No. : | GABRA4-511H |
Product Overview : | Recombinant Human GABRA4 Protein (36-258 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 36-258 aa |
Description : | GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 41.8 kDa |
AA Sequence : | QNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | GABRA4 gamma-aminobutyric acid (GABA) A receptor, alpha 4 [ Homo sapiens ] |
Official Symbol | GABRA4 |
Synonyms | GABRA4; alpha 4; GABA(A) receptor, alpha 4; |
Gene ID | 2557 |
mRNA Refseq | NM_000809 |
Protein Refseq | NP_000800 |
MIM | 137141 |
UniProt ID | P48169 |
◆ Recombinant Proteins | ||
RFL14760HF | Recombinant Full Length Human Gamma-Aminobutyric Acid Receptor Subunit Alpha-4(Gabra4) Protein, His-Tagged | +Inquiry |
GABRA4-2445R | Recombinant Rat GABRA4 Protein | +Inquiry |
GABRA4-7543H | Recombinant Human GABRA4 protein, His-tagged | +Inquiry |
GABRA4-2101R | Recombinant Rat GABRA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRA4-511H | Recombinant Human GABRA4 Protein (36-258 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRA4-6064HCL | Recombinant Human GABRA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRA4 Products
Required fields are marked with *
My Review for All GABRA4 Products
Required fields are marked with *