Recombinant Human GABRA4 Protein (36-258 aa), His-SUMO-tagged
| Cat.No. : | GABRA4-511H |
| Product Overview : | Recombinant Human GABRA4 Protein (36-258 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 36-258 aa |
| Description : | GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 41.8 kDa |
| AA Sequence : | QNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGY |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | GABRA4 gamma-aminobutyric acid (GABA) A receptor, alpha 4 [ Homo sapiens ] |
| Official Symbol | GABRA4 |
| Synonyms | GABRA4; alpha 4; GABA(A) receptor, alpha 4; |
| Gene ID | 2557 |
| mRNA Refseq | NM_000809 |
| Protein Refseq | NP_000800 |
| MIM | 137141 |
| UniProt ID | P48169 |
| ◆ Recombinant Proteins | ||
| GABRA4-7543H | Recombinant Human GABRA4 protein, His-tagged | +Inquiry |
| GABRA4-2995H | Recombinant Human GABRA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GABRA4-2445R | Recombinant Rat GABRA4 Protein | +Inquiry |
| GABRA4-511H | Recombinant Human GABRA4 Protein (36-258 aa), His-SUMO-tagged | +Inquiry |
| GABRA4-2101R | Recombinant Rat GABRA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GABRA4-6064HCL | Recombinant Human GABRA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRA4 Products
Required fields are marked with *
My Review for All GABRA4 Products
Required fields are marked with *
