Recombinant Human GABRA5 protein, GST-tagged
Cat.No. : | GABRA5-13095H |
Product Overview : | Recombinant Human GABRA5 protein(356-423 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 356-423 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYNSIS |
Gene Name | GABRA5 gamma-aminobutyric acid (GABA) A receptor, alpha 5 [ Homo sapiens ] |
Official Symbol | GABRA5 |
Synonyms | GABRA5; gamma-aminobutyric acid (GABA) A receptor, alpha 5; gamma-aminobutyric acid receptor subunit alpha-5; GABA(A) receptor; alpha 5; GABA(A) receptor, alpha 5; GABA(A) receptor subunit alpha-5; MGC138184; |
Gene ID | 2558 |
mRNA Refseq | NM_000810 |
Protein Refseq | NP_000801 |
MIM | 137142 |
UniProt ID | P31644 |
◆ Recombinant Proteins | ||
Gabra5-487M | Recombinant Mouse Gabra5 Protein, MYC/DDK-tagged | +Inquiry |
GABRA5-13095H | Recombinant Human GABRA5 protein, GST-tagged | +Inquiry |
GABRA5-2102R | Recombinant Rat GABRA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRA5-1352H | Recombinant Human GABRA5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GABRA5-5192HF | Recombinant Full Length Human GABRA5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRA5-6063HCL | Recombinant Human GABRA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRA5 Products
Required fields are marked with *
My Review for All GABRA5 Products
Required fields are marked with *