Recombinant Human GABRA5 protein, GST-tagged

Cat.No. : GABRA5-6214H
Product Overview : Recombinant Human GABRA5 protein(36-222 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 36-222 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : SSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRL
Gene Name GABRA5 gamma-aminobutyric acid (GABA) A receptor, alpha 5 [ Homo sapiens ]
Official Symbol GABRA5
Synonyms GABRA5; gamma-aminobutyric acid (GABA) A receptor, alpha 5; gamma-aminobutyric acid receptor subunit alpha-5; GABA(A) receptor; alpha 5; GABA(A) receptor, alpha 5; GABA(A) receptor subunit alpha-5; MGC138184;
Gene ID 2558
mRNA Refseq NM_000810
Protein Refseq NP_000801
MIM 137142
UniProt ID P31644

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GABRA5 Products

Required fields are marked with *

My Review for All GABRA5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon