Recombinant Human GABRB2 protein, His-tagged

Cat.No. : GABRB2-4264H
Product Overview : Recombinant Human GABRB2 protein(P47870)(26-244aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 26-244aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.3 kDa
AA Sequence : SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name GABRB2 gamma-aminobutyric acid (GABA) A receptor, beta 2 [ Homo sapiens ]
Official Symbol GABRB2
Synonyms GABRB2; gamma-aminobutyric acid (GABA) A receptor, beta 2; gamma-aminobutyric acid receptor subunit beta-2; GABA(A) receptor; beta 2; GABA(A) receptor, beta 2; GABA(A) receptor subunit beta-2; gamma-aminobutyric acid A receptor beta 2; MGC119386; MGC119388; MGC119389;
Gene ID 2561
mRNA Refseq NM_000813
Protein Refseq NP_000804
MIM 600232
UniProt ID P47870

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GABRB2 Products

Required fields are marked with *

My Review for All GABRB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon