Recombinant Human GABRB2 protein, His-tagged
| Cat.No. : | GABRB2-4264H |
| Product Overview : | Recombinant Human GABRB2 protein(P47870)(26-244aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-244aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.3 kDa |
| AA Sequence : | SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | GABRB2 gamma-aminobutyric acid (GABA) A receptor, beta 2 [ Homo sapiens ] |
| Official Symbol | GABRB2 |
| Synonyms | GABRB2; gamma-aminobutyric acid (GABA) A receptor, beta 2; gamma-aminobutyric acid receptor subunit beta-2; GABA(A) receptor; beta 2; GABA(A) receptor, beta 2; GABA(A) receptor subunit beta-2; gamma-aminobutyric acid A receptor beta 2; MGC119386; MGC119388; MGC119389; |
| Gene ID | 2561 |
| mRNA Refseq | NM_000813 |
| Protein Refseq | NP_000804 |
| MIM | 600232 |
| UniProt ID | P47870 |
| ◆ Recombinant Proteins | ||
| GABRB2-3431M | Recombinant Mouse GABRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GABRB2-1615R | Recombinant Rhesus Macaque GABRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GABRB2-4646H | Recombinant Human GABRB2 Protein, GST-tagged | +Inquiry |
| GABRB2-1267H | Recombinant Human GABRB2 protein, His-tagged | +Inquiry |
| GABRB2-2994Z | Recombinant Zebrafish GABRB2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GABRB2-6061HCL | Recombinant Human GABRB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRB2 Products
Required fields are marked with *
My Review for All GABRB2 Products
Required fields are marked with *
