Recombinant Human GABRB3 protein, GST-tagged
Cat.No. : | GABRB3-3749H |
Product Overview : | Recombinant Human GABRB3 protein(371-426 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 371-426 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | SLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ] |
Official Symbol | GABRB3 |
Synonyms | GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; GABA(A) receptor; beta 3; GABA(A) receptor, beta 3; GABAA receptor beta-3 subunit; GABA(A) receptor beta-3 subunit; GABA-alpha receptor beta-2 subunit; ECA5; MGC9051; |
Gene ID | 2562 |
mRNA Refseq | NM_000814 |
Protein Refseq | NP_000805 |
UniProt ID | P28472 |
◆ Recombinant Proteins | ||
GABRB3-1795R | Recombinant Rhesus monkey GABRB3 Protein, His-tagged | +Inquiry |
GABRB3-6898C | Recombinant Chicken GABRB3 | +Inquiry |
GABRB3-3749H | Recombinant Human GABRB3 protein, GST-tagged | +Inquiry |
GABRB3-4647H | Recombinant Human GABRB3 Protein, GST-tagged | +Inquiry |
GABRB3-1616R | Recombinant Rhesus Macaque GABRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRB3-6060HCL | Recombinant Human GABRB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRB3 Products
Required fields are marked with *
My Review for All GABRB3 Products
Required fields are marked with *