Recombinant Human GABRE protein, His-tagged
| Cat.No. : | GABRE-13101H |
| Product Overview : | Recombinant Human GABRE protein(28-279 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-279 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | KNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GABRE gamma-aminobutyric acid (GABA) A receptor, epsilon [ Homo sapiens ] |
| Official Symbol | GABRE |
| Synonyms | GABRE; gamma-aminobutyric acid (GABA) A receptor, epsilon; gamma-aminobutyric acid receptor subunit epsilon; GABA(A) receptor; epsilon; GABA(A) receptor, epsilon; GABA(A) receptor subunit epsilon; |
| Gene ID | 2564 |
| mRNA Refseq | NM_004961 |
| Protein Refseq | NP_004952 |
| MIM | 300093 |
| UniProt ID | P78334 |
| ◆ Recombinant Proteins | ||
| GABRE-6798C | Recombinant Chicken GABRE | +Inquiry |
| GABRE-4648H | Recombinant Human GABRE Protein, GST-tagged | +Inquiry |
| GABRE-5200HF | Recombinant Full Length Human GABRE Protein, GST-tagged | +Inquiry |
| GABRE-4960H | Recombinant Human GABRE protein | +Inquiry |
| GABRE-4963H | Recombinant Human GABRE protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GABRE-6059HCL | Recombinant Human GABRE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABRE Products
Required fields are marked with *
My Review for All GABRE Products
Required fields are marked with *
