Recombinant Human GADD45GIP1 Protein, GST-tagged
Cat.No. : | GADD45GIP1-4661H |
Product Overview : | Human GADD45GIP1 full-length ORF ( NP_443082.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GADD45GIP1 growth arrest and DNA-damage-inducible, gamma interacting protein 1 [ Homo sapiens ] |
Official Symbol | GADD45GIP1 |
Synonyms | GADD45GIP1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest and DNA damage-inducible proteins-interacting protein 1; CKBBP2; CKII beta binding protein 2; CR6 interacting factor 1; CRIF1; MGC4667; MGC4758; p53 responsive gene 6; papillomavirus L2 interacting nuclear protein 1; PLINP 1; Plinp1; PRG6; CR6-interacting factor 1; CKII beta-associating protein; p53-responsive gene 6 protein; papillomavirus L2-interacting nuclear protein 1; PLINP-1; |
Gene ID | 90480 |
mRNA Refseq | NM_052850 |
Protein Refseq | NP_443082 |
MIM | 605162 |
UniProt ID | Q8TAE8 |
◆ Recombinant Proteins | ||
GADD45GIP1-5852H | Recombinant Human GADD45GIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GADD45GIP1-26074TH | Recombinant Human GADD45GIP1, His-tagged | +Inquiry |
GADD45GIP1-2459R | Recombinant Rat GADD45GIP1 Protein | +Inquiry |
GADD45GIP1-13112H | Recombinant Human GADD45GIP1, GST-tagged | +Inquiry |
GADD45GIP1-5209HF | Recombinant Full Length Human GADD45GIP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45GIP1-6052HCL | Recombinant Human GADD45GIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45GIP1 Products
Required fields are marked with *
My Review for All GADD45GIP1 Products
Required fields are marked with *
0
Inquiry Basket