Recombinant Human GADD45GIP1 Protein, GST-tagged

• Cat.No.: GADD45GIP1-4661H
• Product Overview: Human GADD45GIP1 full-length ORF ( NP_443082.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators. [provided by RefSeq, Aug 2012]
• Molecular Mass: 51.8 kDa
• AA Sequence: MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GADD45GIP1 growth arrest and DNA-damage-inducible, gamma interacting protein 1 [ Homo sapiens ]
• Official Symbol: GADD45GIP1
• Synonyms: GADD45GIP1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest and DNA damage-inducible proteins-interacting protein 1; CKBBP2; CKII beta binding protein 2; CR6 interacting factor 1; CRIF1; MGC4667; MGC4758; p53 responsive gene 6; papillomavirus L2 interacting nuclear protein 1; PLINP 1; Plinp1; PRG6; CR6-interacting factor 1; CKII beta-associating protein; p53-responsive gene 6 protein; papillomavirus L2-interacting nuclear protein 1; PLINP-1
• Gene ID: 90480
• mRNA Refseq: NM_052850
• Protein Refseq: NP_443082
• MIM: 605162
• UniProt ID: Q8TAE8