Recombinant Human GALE Protein, GST-tagged
Cat.No. : | GALE-4679H |
Product Overview : | Human GALE full-length ORF ( AAH01273, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation, with symptoms ranging from mild (peripheral form) to severe (generalized form). Multiple alternatively spliced transcripts encoding the same protein have been identified. [provided by RefSeq |
Molecular Mass : | 64.02 kDa |
AA Sequence : | MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALE UDP-galactose-4-epimerase [ Homo sapiens ] |
Official Symbol | GALE |
Synonyms | GALE; UDP-galactose-4-epimerase; galactose 4 epimerase, UDP; UDP-glucose 4-epimerase; SDR1E1; short chain dehydrogenase/reductase family 1E; member 1; UDP glucose 4 epimerase; galactowaldenase; UDP-galactose 4-epimerase; UDP galactose-4-epimerase; galactose-4-epimerase, UDP-; short chain dehydrogenase/reductase family 1E, member 1; FLJ95174; FLJ97302; |
Gene ID | 2582 |
mRNA Refseq | NM_000403 |
Protein Refseq | NP_000394 |
MIM | 606953 |
UniProt ID | Q14376 |
◆ Recombinant Proteins | ||
Gale-3136M | Recombinant Mouse Gale Protein, Myc/DDK-tagged | +Inquiry |
GALE-2398H | Recombinant Human GALE Protein (Met1-Ala348), N-His tagged | +Inquiry |
GALE-5810H | Recombinant Human GALE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GALE-9778H | Recombinant Human GALE protein | +Inquiry |
GALE-151H | Recombinant Human GALE Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALE-6043HCL | Recombinant Human GALE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALE Products
Required fields are marked with *
My Review for All GALE Products
Required fields are marked with *
0
Inquiry Basket