Recombinant Human GALNT1 Protein (AA 47-559), N-6×His/GFP tagged
Cat.No. : | GALNT1-28H |
Product Overview : | Recombinant Human GALNT1 Protein (AA 47-559) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 47-559 |
Description : | This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. |
Molecular Mass : | ~92 kDa |
AA Sequence : | VLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDIDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF |
Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens (human) ] |
Official Symbol | GALNT1 |
Synonyms | GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1; pp-GaNTase 1; GalNAc transferase 1; polypeptide GalNAc transferase 1; protein-UDP acetylgalactosaminyltransferase 1; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1; GALNAC-T1; |
Gene ID | 2589 |
mRNA Refseq | NM_020474 |
Protein Refseq | NP_065207 |
MIM | 602273 |
UniProt ID | Q10472 |
◆ Recombinant Proteins | ||
GALNT1-2121R | Recombinant Rat GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT1-27304TH | Recombinant Human GALNT1 | +Inquiry |
GALNT1-1805R | Recombinant Rhesus monkey GALNT1 Protein, His-tagged | +Inquiry |
GALNT1-4689H | Recombinant Human GALNT1 Protein, GST-tagged | +Inquiry |
GALNT1-179HF | Recombinant Full Length Human GALNT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALNT1 Products
Required fields are marked with *
My Review for All GALNT1 Products
Required fields are marked with *
0
Inquiry Basket