Recombinant Human GALNT10 Protein, GST-tagged
Cat.No. : | GALNT10-4691H |
Product Overview : | Human GALNT10 partial ORF ( NP_938080, 503 a.a. - 602 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) gene family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | FTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALNT10 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) [ Homo sapiens ] |
Official Symbol | GALNT10 |
Synonyms | GALNACT10; PPGALNACT10; PPGANTASE10 |
Gene ID | 55568 |
mRNA Refseq | NM_198321 |
Protein Refseq | NP_938080 |
MIM | 608043 |
UniProt ID | Q86SR1 |
◆ Recombinant Proteins | ||
GALNT10-2466R | Recombinant Rat GALNT10 Protein | +Inquiry |
GALNT10-4499Z | Recombinant Zebrafish GALNT10 | +Inquiry |
GALNT10-753H | Recombinant Human GALNT10 Protein, His-tagged | +Inquiry |
GALNT10-13131H | Recombinant Human GALNT10, GST-tagged | +Inquiry |
GALNT10-291H | Recombinant Human GALNT10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT10-6039HCL | Recombinant Human GALNT10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT10 Products
Required fields are marked with *
My Review for All GALNT10 Products
Required fields are marked with *