Recombinant Human GALNT2
| Cat.No. : | GALNT2-27303TH |
| Product Overview : | Recombinant fragment of Human GALNT2 with an N terminal proprietary tag; Predicted MW 36.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | This gene encodes polypeptide N-acetylgalactosaminyltransferase 2, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation in a cell is regulated by a repertoire of GalNAc-transferases. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | Widely expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ |
| Sequence Similarities : | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain. |
| Gene Name | GALNT2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2) [ Homo sapiens ] |
| Official Symbol | GALNT2 |
| Synonyms | GALNT2; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2); polypeptide N-acetylgalactosaminyltransferase 2; GalNAc T2; |
| Gene ID | 2590 |
| mRNA Refseq | NM_004481 |
| Protein Refseq | NP_004472 |
| MIM | 602274 |
| Uniprot ID | Q10471 |
| Chromosome Location | 1q41-q42 |
| Pathway | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; |
| Function | manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups; |
| ◆ Recombinant Proteins | ||
| GALNT2-6185M | Recombinant Mouse GALNT2 Protein | +Inquiry |
| GALNT2-1265H | Recombinant Human GALNT2 protein, His-tagged | +Inquiry |
| GALNT2-1628R | Recombinant Rhesus Macaque GALNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GALNT2-6862Z | Recombinant Zebrafish GALNT2 | +Inquiry |
| GALNT2-1478H | Recombinant Human GALNT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT2 Products
Required fields are marked with *
My Review for All GALNT2 Products
Required fields are marked with *
