Recombinant Human GALNT2

Cat.No. : GALNT2-27303TH
Product Overview : Recombinant fragment of Human GALNT2 with an N terminal proprietary tag; Predicted MW 36.52kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : This gene encodes polypeptide N-acetylgalactosaminyltransferase 2, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation in a cell is regulated by a repertoire of GalNAc-transferases.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Widely expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
Sequence Similarities : Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain.
Gene Name GALNT2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2) [ Homo sapiens ]
Official Symbol GALNT2
Synonyms GALNT2; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2); polypeptide N-acetylgalactosaminyltransferase 2; GalNAc T2;
Gene ID 2590
mRNA Refseq NM_004481
Protein Refseq NP_004472
MIM 602274
Uniprot ID Q10471
Chromosome Location 1q41-q42
Pathway Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem;
Function manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GALNT2 Products

Required fields are marked with *

My Review for All GALNT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon