Recombinant Human GALNT2 Protein, GST-tagged
Cat.No. : | GALNT2-4699H |
Product Overview : | Human GALNT2 partial ORF ( NP_004472, 473 a.a. - 571 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes polypeptide N-acetylgalactosaminyltransferase 2, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation in a cell is regulated by a repertoire of GalNAc-transferases. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALNT2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2) [ Homo sapiens ] |
Official Symbol | GALNT2 |
Synonyms | GALNT2; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2); polypeptide N-acetylgalactosaminyltransferase 2; GalNAc T2; pp-GaNTase 2; UDP-GalNAc transferase 2; polypeptide GalNAc transferase 2; protein-UDP acetylgalactosaminyltransferase 2; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2; GalNAc-T2; |
Gene ID | 2590 |
mRNA Refseq | NM_004481 |
Protein Refseq | NP_004472 |
MIM | 602274 |
UniProt ID | Q10471 |
◆ Recombinant Proteins | ||
GALNT2-1265H | Recombinant Human GALNT2 protein, His-tagged | +Inquiry |
GALNT2-6185M | Recombinant Mouse GALNT2 Protein | +Inquiry |
GALNT2-1628R | Recombinant Rhesus Macaque GALNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT2-13136H | Recombinant Human GALNT2, His-tagged | +Inquiry |
GALNT2-1478H | Recombinant Human GALNT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT2 Products
Required fields are marked with *
My Review for All GALNT2 Products
Required fields are marked with *