Recombinant Human GALNT2 Protein, GST-tagged
| Cat.No. : | GALNT2-4699H |
| Product Overview : | Human GALNT2 partial ORF ( NP_004472, 473 a.a. - 571 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes polypeptide N-acetylgalactosaminyltransferase 2, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation in a cell is regulated by a repertoire of GalNAc-transferases. [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GALNT2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2) [ Homo sapiens ] |
| Official Symbol | GALNT2 |
| Synonyms | GALNT2; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2); polypeptide N-acetylgalactosaminyltransferase 2; GalNAc T2; pp-GaNTase 2; UDP-GalNAc transferase 2; polypeptide GalNAc transferase 2; protein-UDP acetylgalactosaminyltransferase 2; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2; GalNAc-T2; |
| Gene ID | 2590 |
| mRNA Refseq | NM_004481 |
| Protein Refseq | NP_004472 |
| MIM | 602274 |
| UniProt ID | Q10471 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT2 Products
Required fields are marked with *
My Review for All GALNT2 Products
Required fields are marked with *



