Recombinant Human GAS8-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GAS8-AS1-6285H
Product Overview : C16orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001205) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a long non-coding RNA (lncRNA) that may function as a tumor suppressor. Mutations in this gene have been identified in human papillary thyroid carcinoma (PTC) patients that abrogate the ability of encoded lncRNA to inhibit cancer cell growth.
Molecular Mass : 11.9 kDa
AA Sequence : MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPIACPVSCPVACPVGCPVGSMATAPQGLSPQEWEADRETGSSSHAGTTQCSIHSPSSSSRHLSRTQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GAS8-AS1 GAS8 antisense RNA 1 [ Homo sapiens (human) ]
Official Symbol GAS8-AS1
Synonyms GAS8-AS1; GAS8 antisense RNA 1; C16orf3; MGC132509
Gene ID 750
mRNA Refseq NM_001214
Protein Refseq NP_001205
MIM 605179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAS8-AS1 Products

Required fields are marked with *

My Review for All GAS8-AS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon