Recombinant Human GAS8-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GAS8-AS1-6285H |
Product Overview : | C16orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001205) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a long non-coding RNA (lncRNA) that may function as a tumor suppressor. Mutations in this gene have been identified in human papillary thyroid carcinoma (PTC) patients that abrogate the ability of encoded lncRNA to inhibit cancer cell growth. |
Molecular Mass : | 11.9 kDa |
AA Sequence : | MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPIACPVSCPVACPVGCPVGSMATAPQGLSPQEWEADRETGSSSHAGTTQCSIHSPSSSSRHLSRTQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GAS8-AS1 GAS8 antisense RNA 1 [ Homo sapiens (human) ] |
Official Symbol | GAS8-AS1 |
Synonyms | GAS8-AS1; GAS8 antisense RNA 1; C16orf3; MGC132509 |
Gene ID | 750 |
mRNA Refseq | NM_001214 |
Protein Refseq | NP_001205 |
MIM | 605179 |
◆ Recombinant Proteins | ||
GAS8-AS1-605H | Recombinant Human GAS8-AS1 Protein, MYC/DDK-tagged | +Inquiry |
GAS8-AS1-6285H | Recombinant Human GAS8-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAS8-AS1 Products
Required fields are marked with *
My Review for All GAS8-AS1 Products
Required fields are marked with *