Recombinant Human GAS8-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GAS8-AS1-6285H
• Product Overview: C16orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001205) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a long non-coding RNA (lncRNA) that may function as a tumor suppressor. Mutations in this gene have been identified in human papillary thyroid carcinoma (PTC) patients that abrogate the ability of encoded lncRNA to inhibit cancer cell growth.
• Molecular Mass: 11.9 kDa
• AA Sequence: MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPIACPVSCPVACPVGCPVGSMATAPQGLSPQEWEADRETGSSSHAGTTQCSIHSPSSSSRHLSRTQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GAS8-AS1 GAS8 antisense RNA 1 [ Homo sapiens (human) ]
• Official Symbol: GAS8-AS1
• Synonyms: GAS8-AS1; GAS8 antisense RNA 1; C16orf3; MGC132509
• Gene ID: 750
• mRNA Refseq: NM_001214
• Protein Refseq: NP_001205
• MIM: 605179