Recombinant Human GATA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GATA2-602H |
Product Overview : | GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GATA2 GATA binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | GATA2 |
Synonyms | GATA2; GATA binding protein 2; endothelial transcription factor GATA-2; NFE1B; DCML; MONOMAC; MGC2306; FLJ45948; |
Gene ID | 2624 |
mRNA Refseq | NM_032638 |
Protein Refseq | NP_116027 |
MIM | 137295 |
UniProt ID | P23769 |
◆ Recombinant Proteins | ||
GATA2-476H | Recombinant Human GATA2 Protein, His-tagged | +Inquiry |
GATA2-2792H | Recombinant Human GATA2 Protein (Pro175-Gly480), His tagged | +Inquiry |
GATA2-602H | Recombinant Human GATA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GATA2-4745H | Recombinant Human GATA2 Protein, GST-tagged | +Inquiry |
Gata2-477M | Recombinant Mouse Gata2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA2-6013HCL | Recombinant Human GATA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA2 Products
Required fields are marked with *
My Review for All GATA2 Products
Required fields are marked with *
0
Inquiry Basket